PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1288_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 506aa    MW: 57815.8 Da    PI: 6.567
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1288_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.6e-103473841954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LAk++gL+++qV +WF N R +
  RrC1288_p4 347 FEHflHPYPKDSEKMMLAKQTGLSKNQVANWFINARVR 384
                 554459******************************88 PP

2BELL108.83.2e-35207276372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +elq+kk+kLl +++eVdkrY+qy++q+++++ssFe+vag g++kpYts+Al++iSr+Fr+L+d i eqi
  RrC1288_p4 207 TELQNKKNKLLAMVDEVDKRYNQYYHQMEALASSFEIVAGFGASKPYTSVALNKISRSFRSLRDTIEEQI 276
                 69*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-36153274IPR006563POX domain
PfamPF075266.6E-38159272IPR006563POX domain
PROSITE profilePS5007112.503325388IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-26327398IPR009057Homeodomain-like
SMARTSM003893.4E-9328392IPR001356Homeobox domain
CDDcd000866.56E-11328389No hitNo description
SuperFamilySSF466891.03E-16329393IPR009057Homeodomain-like
PfamPF059201.5E-17345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MEVYYSSNVN YYQQEPIFLN HQQQQQEASS SSEHVRNEMV FIPPTTGTTG VVTGLQNLNG  60
TVSSSDQSFH DGQGLSLTLG NQISLPSFHH HQQYHHHQLG FTPNNPSISV KETPPFNLEE  120
EKSKEMMSSL LLLCQSNPSS GYAAGLYNNY RYNETSGGLR FSRYLKPAQS LLGEVVSVKK  180
EMRNKKMKGQ DFNNGSKDTE SGELSTTELQ NKKNKLLAMV DEVDKRYNQY YHQMEALASS  240
FEIVAGFGAS KPYTSVALNK ISRSFRSLRD TIEEQIQIIR EKLGEKGGES DEQQQGGGER  300
IPRLRYLDQR LRQQRAFHQQ IGMVRPSWRP QRGLPENSVS ALRAWLFEHF LHPYPKDSEK  360
MMLAKQTGLS KNQVANWFIN ARVRLWKPMI EDIYKQEFGG DESELRISKS SQEPNSTNQE  420
DSSSSQQQPE DNSNTTYPSA DATKTVFSSD EPKQQEVNRS GDYETLLNNY QGYVMEEDYR  480
YNNIGGNNQQ DSRFSNAHHH LHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B5e-15334391562Homeobox protein Meis2
3k2a_A5e-15334391562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3526000.0AK352600.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-C02.
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587448.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_013587449.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0D3CBK80.0A0A0D3CBK8_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10